DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and spoplb

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001073438.1 Gene:spoplb / 558170 ZFINID:ZDB-GENE-061103-277 Length:380 Species:Danio rerio


Alignment Length:198 Identity:55/198 - (27%)
Similarity:89/198 - (44%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSAIFKVL 87
            |.|..|:::|||...|..::.|.||.||::.||||.|||...|:.:: :..::|.|:...:|:.:
Zfish   179 GNLWEGSRFTDCSLFVGGQEFKAHKSILAARSPVFNAMFEHKMEESK-KNRVDISDVEPDVFREM 242

  Fly    88 VEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSVCMGLDG 152
            :.:||||...  .||.:| ..|..||:||.||.|.......:...|...|:...|.|:.....:.
Zfish   243 MVFIYTGKAP--NLEKMA-DNLLAAADKYALERLKVLCEEALCNSLSVENVADVLILADLHSAEQ 304

  Fly   153 LLEVCMTFFMRCCVN-----------NGQYMSHLKE---------HYVHVSKECVKAIIAACKEP 197
            |....:.|..||.|.           |..:.:.:.|         .:.|:..|..:|:.:|...|
Zfish   305 LKAQAIDFINRCSVLRQLGCKDGKNWNSNHAADIMETAGWKAMIQSHPHLVAEAFRALASAQCTP 369

  Fly   198 HKL 200
            ..|
Zfish   370 FGL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 37/98 (38%)
BTB 33..122 CDD:197585 33/88 (38%)
spoplbNP_001073438.1 MATH 16..154 CDD:295307
BTB 178..282 CDD:279045 38/106 (36%)
BTB 189..285 CDD:197585 34/99 (34%)
SPOP_C 285..365 CDD:269807 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.