Sequence 1: | NP_611649.1 | Gene: | CG11275 / 37534 | FlyBaseID: | FBgn0034706 | Length: | 417 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013465.1 | Gene: | spopla / 541318 | ZFINID: | ZDB-GENE-050320-3 | Length: | 392 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 57/198 - (28%) |
---|---|---|---|
Similarity: | 92/198 - (46%) | Gaps: | 29/198 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSAIFKVL 87
Fly 88 VEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSVCMGLDG 152
Fly 153 LLEVCMTFFMRCCV------NNGQ---------------YMSHLKEHYVHVSKECVKAIIAA-CK 195
Fly 196 EPH 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11275 | NP_611649.1 | BTB | 22..122 | CDD:279045 | 37/98 (38%) |
BTB | 33..122 | CDD:197585 | 34/88 (39%) | ||
spopla | NP_001013465.1 | MATH | 28..166 | CDD:295307 | |
BTB | 190..294 | CDD:279045 | 38/106 (36%) | ||
BTB | 201..297 | CDD:197585 | 35/99 (35%) | ||
SPOP_C | 297..377 | CDD:269807 | 15/80 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24413 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X131 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |