DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and RGD1559714

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001094466.1 Gene:RGD1559714 / 502570 RGDID:1559714 Length:268 Species:Rattus norvegicus


Alignment Length:81 Identity:32/81 - (39%)
Similarity:48/81 - (59%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSA 82
            |....|:|...:.:|||...|..::::.||.||::.||||.|||...|.:: ....||||||...
  Rat   174 LAEDLGELWENSLFTDCSLVVAGQEIRSHKAILAARSPVFRAMFEHEMLDS-LRNRIEIHDIHLQ 237

  Fly    83 IFKVLVEYIYTGVVDY 98
            :||.::.:||||.|.:
  Rat   238 VFKEMMHFIYTGTVPH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 31/77 (40%)
BTB 33..122 CDD:197585 28/66 (42%)
RGD1559714NP_001094466.1 MATH 16..153 CDD:295307
BTB 178..268 CDD:279045 31/77 (40%)
BTB 189..>268 CDD:197585 28/66 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.