DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and rdx

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster


Alignment Length:104 Identity:35/104 - (33%)
Similarity:53/104 - (50%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSA 82
            |....|.|....|::|....|...:.:.||.||::.|.||.|||...|:..:.. .:.|.|:...
  Fly   641 LSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLN-RVAITDVDHE 704

  Fly    83 IFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEEL 121
            :.|.::.:||||...  .||.:| .:|..||:||.||:|
  Fly   705 VLKEMLRFIYTGKAP--NLEKMA-DDLLAAADKYALEKL 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 34/100 (34%)
BTB 33..122 CDD:197585 31/89 (35%)
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB 645..749 CDD:279045 34/100 (34%)
BTB 656..752 CDD:197585 31/89 (35%)
SPOP_C 752..814 CDD:269807
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
33.010

Return to query results.
Submit another query.