DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and Tdpoz4

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_997155.2 Gene:Tdpoz4 / 399675 MGIID:3027904 Length:370 Species:Mus musculus


Alignment Length:195 Identity:56/195 - (28%)
Similarity:91/195 - (46%) Gaps:24/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPE------IEIHDISS 81
            |:|.....:|||...|...:.:.||.||::.||||.|||       |.|.|      :||||:..
Mouse   179 GELWENPLFTDCSLLVAGHEFRAHKAILAARSPVFRAMF-------EHEMEERLTNCVEIHDLDP 236

  Fly    82 AIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSV 146
            .:||.::.:||||.|.:.....:|| :|..||::|.||:|:......:.|.|...|....|.::.
Mouse   237 QVFKEMMGFIYTGKVPHLHSHSMAC-DLLAAADRYGLEDLMVMCEDALCRSLSVENAAHTLIVAD 300

  Fly   147 CMGLDGL----LEVCMTFFMRCCVNNGQYMSHLKEHYVHVSKECVKAIIAACKE----PHKLLIW 203
            ....:.|    |:..:.:.......:| :||.::.| ..:..|...::.:|.:.    |.|.|.|
Mouse   301 LHSTEHLKTQALDFIIVYASEVSKTSG-WMSMVESH-PRLVAEAFHSLASAQRVFWALPFKQLKW 363

  Fly   204  203
            Mouse   364  363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 39/104 (38%)
BTB 33..122 CDD:197585 36/94 (38%)
Tdpoz4NP_997155.2 MATH 16..154 CDD:295307
BTB 180..284 CDD:279045 39/111 (35%)
BTB 189..287 CDD:197585 38/105 (36%)
SPOP_C 287..349 CDD:269807 10/63 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.