Sequence 1: | NP_611649.1 | Gene: | CG11275 / 37534 | FlyBaseID: | FBgn0034706 | Length: | 417 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997155.2 | Gene: | Tdpoz4 / 399675 | MGIID: | 3027904 | Length: | 370 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 56/195 - (28%) |
---|---|---|---|
Similarity: | 91/195 - (46%) | Gaps: | 24/195 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPE------IEIHDISS 81
Fly 82 AIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSV 146
Fly 147 CMGLDGL----LEVCMTFFMRCCVNNGQYMSHLKEHYVHVSKECVKAIIAACKE----PHKLLIW 203
Fly 204 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11275 | NP_611649.1 | BTB | 22..122 | CDD:279045 | 39/104 (38%) |
BTB | 33..122 | CDD:197585 | 36/94 (38%) | ||
Tdpoz4 | NP_997155.2 | MATH | 16..154 | CDD:295307 | |
BTB | 180..284 | CDD:279045 | 39/111 (35%) | ||
BTB | 189..287 | CDD:197585 | 38/105 (36%) | ||
SPOP_C | 287..349 | CDD:269807 | 10/63 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24413 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X131 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |