DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and SPOPL

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001001664.1 Gene:SPOPL / 339745 HGNCID:27934 Length:392 Species:Homo sapiens


Alignment Length:222 Identity:59/222 - (26%)
Similarity:95/222 - (42%) Gaps:44/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSA 82
            |....|.|....::|||.|.|..::.|.||.:|::.||||.|||...|:.:: :..:||:|:...
Human   186 LAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESK-KNRVEINDLDPE 249

  Fly    83 IFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSVC 147
            :||.::.:||||...  .|:.:| ..|..||:||.||.|.......:...|...|:...|.|:..
Human   250 VFKEMMRFIYTGRAP--NLDKMA-DNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADL 311

  Fly   148 MGLDGLLEVCMTFFMRCCV------------NNGQ---------YMSHLKEHYVHVSKECVKAII 191
            ...:.|....:.|..||.|            |:.|         :.|.::.| .|:..|..:|:.
Human   312 HSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSH-PHLVAEAFRALA 375

  Fly   192 AACKEPHKLLIWYVYEWTRQECEQLGL 218
            :|                  :|.|.|:
Human   376 SA------------------QCPQFGI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 37/99 (37%)
BTB 33..122 CDD:197585 34/88 (39%)
SPOPLNP_001001664.1 MATH 28..166 CDD:351761
BTB_POZ_SPOPL 179..301 CDD:349652 40/118 (34%)
BACK_SPOPL 297..392 CDD:350594 20/107 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.