DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and CG17068

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster


Alignment Length:305 Identity:76/305 - (24%)
Similarity:110/305 - (36%) Gaps:107/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQ-LLRGAKYTDCVFHV----CEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSA 82
            || ||...|:.||.|.|    .:..:..|||:|:.||||||.||:|.:. ::.:| |.|.|:...
  Fly    16 GQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLP-DKTDP-IVIPDVQPE 78

  Fly    83 IFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRF--ANILPALELS 145
            .|:.::|||||..:.....: .|| ||.|.|:||:|..       |:||...|  |::.|.    
  Fly    79 AFEAMLEYIYTDRITIGSFD-KAC-ELCYVAKKYMLPH-------VVTRCTHFLWADLSPK---- 130

  Fly   146 VCMGLDGLLEVCMTFFMRCCVNNGQYMSHLKEHYVHVSKECVKAIIAACKEPHKLLIWYVYEWTR 210
                                                          .||:         .||:.:
  Fly   131 ----------------------------------------------NACR---------AYEFAK 140

  Fly   211 QECEQLGLGPSDADLVVHDLGGKTSDWPAASGASDLESPALTPVVLVERCYYKACRPFTVDAETP 275
            . .::..|..|..||:..:.....||    ....|:|...|..::...|        ..:|:|..
  Fly   141 L-FDEPRLMQSSMDLIAANTREVLSD----PSFLDIEVSTLMAILDQNR--------LNIDSELD 192

  Fly   276 LFRLRLKCSRFISLMGL--------------VLNSRLTPNLLGHV 306
            ||...||   |.|..|:              ||......|..|||
  Fly   193 LFNCLLK---FASERGILNESGQEETASGGQVLTKESPDNAAGHV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 41/103 (40%)
BTB 33..122 CDD:197585 36/92 (39%)
CG17068NP_608379.1 BTB 19..123 CDD:279045 42/114 (37%)
BTB 27..127 CDD:197585 41/110 (37%)
BACK 136..>199 CDD:197943 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.