DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and BTBD9

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster


Alignment Length:382 Identity:83/382 - (21%)
Similarity:156/382 - (40%) Gaps:72/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRY----GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHD 78
            ||.|:    .:|....:|.|..|.|.||::..|::||::.|..|.|:.:|.|... .:.:|.: :
  Fly    28 LGDRFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAET-TQRQIPL-E 90

  Fly    79 ISSAIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALE 143
            :....||||:.|||:|.:..:.|:..:.|::...|.:|..::|.......:.:.|...|:...|:
  Fly    91 VPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILD 155

  Fly   144 LSVCMGLDGLLEVCMTFFMRCCVNNGQYMSHLKEHYVHVSKECVKAIIAA-C-KEPHKLLIWYVY 206
            .:....|:.|.|||:.|..|   |.|..:.|  ..:..:|||.::.::.. | ..|...:...|:
  Fly   156 AARLYNLEELTEVCLMFMDR---NAGDLLLH--NSFNTLSKESLEEVLRRDCFFAPEVQIFLAVW 215

  Fly   207 EWTR------------------QECEQL--GLGPS---DADLVVHDLGGKTSD---------WPA 239
            :|:|                  ...|.|  .:.||   |.|.::..:..:::.         ||.
  Fly   216 KWSRFNSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWPE 280

  Fly   240 ASGASDLESPALTPVVLVERCYYKACRPFTVDAETPLFRLR----LKCSRFISLMGLVLNSRLTP 300
            .:.|::         ..:.||....||...:|.:...:.:.    ..|.......|:|:... |.
  Fly   281 ENVAAE---------TFLSRCIQGECRDALLDGDVTTYDMENGYTRHCITDSKDAGIVVELG-TF 335

  Fly   301 NLLGHVQQLEY-RESLRLD-LCEVPAESEGPATSPVWSHVVQSQNTKYNCNLHLGWR 355
            .::.|::.|.: |:|.... ..||..:.:.      |..||...:  |:|.   .|:
  Fly   336 CMINHIRMLLWDRDSRAYSYYVEVSGDQQH------WDRVVDYSD--YHCR---SWQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 28/103 (27%)
BTB 33..122 CDD:197585 26/88 (30%)
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 28/100 (28%)
BTB 47..145 CDD:197585 27/99 (27%)
BACK_BTBD9_like 145..203 CDD:269811 16/62 (26%)
F5_F8_type_C 299..399 CDD:304887 17/95 (18%)
F5_F8_type_C 451..554 CDD:279139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.