DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and RGD1566337

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_003749378.2 Gene:RGD1566337 / 310589 RGDID:1566337 Length:364 Species:Rattus norvegicus


Alignment Length:170 Identity:49/170 - (28%)
Similarity:79/170 - (46%) Gaps:4/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSAIFKVL 87
            |:|.....:|||...|..::.:.||.||::.||||.|||...|..:... .||||||...:||.:
  Rat   179 GELWENFIFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHEMLESLTN-RIEIHDIHLHVFKEM 242

  Fly    88 VEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSVCMGLDG 152
            :.:||||...:.....:| ..|..||:.|.|::|.......:.|.|...|.:..|.|:.....:.
  Rat   243 MGFIYTGKAPHLHSHSMA-TRLLAAADMYDLQDLKVMCEDALCRNLSVENAVSTLILADFHSTEH 306

  Fly   153 LLEVCMTFFMRCC--VNNGQYMSHLKEHYVHVSKECVKAI 190
            |....|.|.:...  |:.......:.|.:.|:.:|..:::
  Rat   307 LKTKAMDFIILHASEVSETLGWKSMVESHPHLVEEAFRSL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 36/98 (37%)
BTB 33..122 CDD:197585 33/88 (38%)
RGD1566337XP_003749378.2 MATH 16..153 CDD:351761
BTB_POZ 165..292 CDD:365784 39/114 (34%)
BACK 287..353 CDD:421692 11/60 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.