DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and Spopl

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_017447114.1 Gene:Spopl / 296532 RGDID:1305847 Length:424 Species:Rattus norvegicus


Alignment Length:221 Identity:56/221 - (25%)
Similarity:91/221 - (41%) Gaps:42/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSA 82
            |....|.|....::|||.|.|..::.|.||.:|::.||||.|||...|:.. .:..:||:|:...
  Rat   218 LAEDLGNLWENTRFTDCCFFVRGKEFKAHKSVLAARSPVFNAMFEHEMEEC-TKNRVEINDLDPE 281

  Fly    83 IFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSVC 147
            :||.::.::|||...  .|:.:| ..|..||:||.||.|.......:...|...|:...|.|:..
  Rat   282 VFKEMMRFVYTGKAP--NLDKMA-DNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADL 343

  Fly   148 MGLDGLLEVCMTFFMRCCV------------NNGQYMSHLK--------EHYVHVSKECVKAIIA 192
            ...:.|....:.|..||.|            ||.|....::        :...|:..|..:|:.:
  Rat   344 HSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNNNQATDIMETSGWKSMIQSRPHLVAEAFRALAS 408

  Fly   193 ACKEPHKLLIWYVYEWTRQECEQLGL 218
            :                  :|.|.|:
  Rat   409 S------------------QCPQFGI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 36/99 (36%)
BTB 33..122 CDD:197585 33/88 (38%)
SpoplXP_017447114.1 MATH 28..160 CDD:351761
BTB_POZ 211..333 CDD:365784 39/118 (33%)
BACK_SPOPL 329..424 CDD:350594 18/106 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.