DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and BTBD3

DIOPT Version :10

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_055777.1 Gene:BTBD3 / 22903 HGNCID:15854 Length:522 Species:Homo sapiens


Alignment Length:41 Identity:13/41 - (31%)
Similarity:21/41 - (51%) Gaps:6/41 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1721 MQDFITQKICKMESDCEKPSEVDRVFKQALR----EFKDNL 1757
            ::.|..::|.|  ..|.:..|.||..:.|||    |:|:.|
Human    19 LKSFWEKEIHK--QTCYRELEEDRQGRSALRKLREEWKERL 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB_POZ_ZBTB_KLHL-like 31..116 CDD:349497
BTBD3NP_055777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..44 6/20 (30%)
BTB_POZ_BTBD3 99..229 CDD:349657
BACK_BTBD3 220..314 CDD:350599
PHR 376..521 CDD:462339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.