DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and Spop

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001346036.1 Gene:Spop / 20747 MGIID:1343085 Length:374 Species:Mus musculus


Alignment Length:104 Identity:38/104 - (36%)
Similarity:61/104 - (58%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSA 82
            |....|.|...:::|||...|..::.:.||.||::.||||.|||...|:.:: :..:||:|:...
Mouse   186 LADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESK-KNRVEINDVEPE 249

  Fly    83 IFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEEL 121
            :||.::.:||||...  .|:.:| .:|..||:||.||.|
Mouse   250 VFKEMMCFIYTGKAP--NLDKMA-DDLLAAADKYALERL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 37/100 (37%)
BTB 33..122 CDD:197585 34/89 (38%)
SpopNP_001346036.1 MATH_SPOP 28..166 CDD:239743
Required for nuclear localization. /evidence=ECO:0000250 71..191 1/4 (25%)
Important for binding substrate proteins. /evidence=ECO:0000250 123..133
BTB_POZ_SPOP-like 182..301 CDD:349588 38/104 (37%)
Important for homodimerization. /evidence=ECO:0000250 186..217 9/30 (30%)
BACK_SPOP 297..367 CDD:350593
Important for homodimerization. /evidence=ECO:0000250 297..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.