DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and bath-41

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_498473.1 Gene:bath-41 / 175946 WormBaseID:WBGene00018137 Length:418 Species:Caenorhabditis elegans


Alignment Length:172 Identity:33/172 - (19%)
Similarity:69/172 - (40%) Gaps:25/172 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YGQLLRGAKYTDCVFHV-CEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSAIFK 85
            :.:.|...:::|.:... |..:...|..||::.|..|:.:.............::..|||:....
 Worm   222 FTEFLSTGEFSDFIIVASCGREFPTHMCILAARSEYFKVLLRNHSTKEFMSKRLQFDDISARTLD 286

  Fly    86 VLVEYIYTG----VVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSV 146
            ||:.::|..    ||.....:|..  :|..|.::.::..|..:...:|..|:...|:|..:.::.
 Worm   287 VLLRHMYASAAGRVVKLEEDQLTE--DLISAMDRLMINSLRDEVARLIGSKVTVDNVLTRISMAA 349

  Fly   147 CMGLDGLLEVCMTFFMRCCVNNGQYMSHLKEHYVHVSKECVK 188
            .:.||...:|.:.||               .::.|   ||:|
 Worm   350 ELRLDDTYDVLLDFF---------------SNHKH---ECMK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 19/104 (18%)
BTB 33..122 CDD:197585 18/93 (19%)
bath-41NP_498473.1 MATH 43..178 CDD:295307
BTB 222..332 CDD:279045 20/111 (18%)
BTB 233..332 CDD:197585 19/100 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.