DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and bath-44

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_495549.1 Gene:bath-44 / 174210 WormBaseID:WBGene00015567 Length:397 Species:Caenorhabditis elegans


Alignment Length:165 Identity:45/165 - (27%)
Similarity:75/165 - (45%) Gaps:35/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGSVSSGLGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIE 75
            |..|:..|...|    |..|:.|....|.|.::|.||.||::.||||.||    |:.:..|.:..
 Worm   193 PSDVTKDLENLY----RSGKHADFTLVVEERELKAHKAILAARSPVFAAM----MEPHTAEAQNS 249

  Fly    76 ---IHDISSAIFKVLVEYIYTGV---VDYNGLELVACIELYYAAEKYLLEEL--IADTLM----- 127
               :.||...:.:.::.|||||.   :..|.|:::|      |||::.|..|  ||:..|     
 Worm   250 RAILRDIDYEVVQAILYYIYTGTCTNMGGNALDILA------AAERFALPGLKNIAEVAMRNGLA 308

  Fly   128 --VITRKLRFANILPALELS------VCMGLDGLL 154
              .:.:.|.||.:...::..      :||..:.::
 Worm   309 TETVCKNLAFAEMYGLVDFKKEAIKYICMNANAVI 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 34/107 (32%)
BTB 33..122 CDD:197585 31/96 (32%)
bath-44NP_495549.1 MATH 26..174 CDD:238068
BTB 200..303 CDD:279045 37/116 (32%)
BTB 211..307 CDD:197585 34/105 (32%)
SPOP_C 307..369 CDD:269807 5/37 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.