DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and bath-40

DIOPT Version :10

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_493543.1 Gene:bath-40 / 173321 WormBaseID:WBGene00013689 Length:402 Species:Caenorhabditis elegans


Alignment Length:149 Identity:39/149 - (26%)
Similarity:66/149 - (44%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSAIFKVLVEYIYTGVVDYNGLELVA 105
            ||.:.|...|.:.|.||:.|..........|..|||.|.|....:.:||:||.||:. :.:::..
 Worm   236 EQFRVHAYKLRAHSDVFQMMLSHTEMRENQEKRIEILDFSPTSVRAMVEFIYAGVIK-SDIDVYQ 299

  Fly   106 CIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELSVCMGLDGLLEVCMTFFMRCCVNNGQ 170
            .:::...||||.:..|.......:..:|...|:|..:..:.....|.|.:.|:.|    .::|.|
 Worm   300 AVDVMQIAEKYQILALKMTCEQHLLDRLNVNNVLECITHAERYNTDVLYDACVDF----AIHNRQ 360

  Fly   171 YMSHLKEHYVHVSKECVKA 189
            ::..|......:|.|.|.|
 Worm   361 HVMALTSWRNFISDEPVLA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB_POZ_ZBTB_KLHL-like 31..116 CDD:349497 22/74 (30%)
bath-40NP_493543.1 MATH 44..178 CDD:238068
BTB 214..327 CDD:395526 25/91 (27%)
BACK 328..375 CDD:350515 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.