DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and mel-26

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001263463.1 Gene:mel-26 / 172737 WormBaseID:WBGene00003209 Length:399 Species:Caenorhabditis elegans


Alignment Length:112 Identity:32/112 - (28%)
Similarity:52/112 - (46%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EPGSVSSGLGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEI 74
            ||.:....|...|.:|.......|...:|..:.::.||.:|::.||||.||......:......:
 Worm   179 EPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMM 243

  Fly    75 EIHDISSAIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEEL 121
            .|:|:...:...:|.|||.|..:.:..::...  |..||:||.||||
 Worm   244 YINDMDYDVIYEMVYYIYCGRCNKDITDMATA--LLIAADKYRLEEL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 29/100 (29%)
BTB 33..122 CDD:197585 27/89 (30%)
mel-26NP_001263463.1 MATH 38..157 CDD:295307
BTB 191..297 CDD:279045 29/100 (29%)
BTB 202..300 CDD:197585 27/89 (30%)
SPOP_C 300..366 CDD:269807
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.