DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and mel-26

DIOPT Version :10

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001263463.1 Gene:mel-26 / 172737 WormBaseID:WBGene00003209 Length:399 Species:Caenorhabditis elegans


Alignment Length:112 Identity:32/112 - (28%)
Similarity:52/112 - (46%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EPGSVSSGLGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEI 74
            ||.:....|...|.:|.......|...:|..:.::.||.:|::.||||.||......:......:
 Worm   179 EPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMM 243

  Fly    75 EIHDISSAIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEEL 121
            .|:|:...:...:|.|||.|..:.:..::...  |..||:||.||||
 Worm   244 YINDMDYDVIYEMVYYIYCGRCNKDITDMATA--LLIAADKYRLEEL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB_POZ_ZBTB_KLHL-like 31..116 CDD:349497 21/84 (25%)
mel-26NP_001263463.1 MATH 38..157 CDD:445786
BTB_POZ 184..305 CDD:453885 30/107 (28%)
BACK 302..360 CDD:475122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.