DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and LOC100911679

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_003749384.1 Gene:LOC100911679 / 100911679 RGDID:6491125 Length:358 Species:Rattus norvegicus


Alignment Length:222 Identity:63/222 - (28%)
Similarity:96/222 - (43%) Gaps:41/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KEPGSVSSGLGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPE 73
            |:|..:   |....|:|...:.:|||...|..::.:.||.||:..||||.|||...||..... .
  Rat   168 KDPRQI---LADDVGELWENSLFTDCSLVVAGQEFRAHKAILAGHSPVFRAMFEHEMQERLTN-R 228

  Fly    74 IEIHDISSAIFKVLVEYIYTGVVDY-----NGLELVACIELYYAAEKYLLEELIADTLMVITRKL 133
            ||.|||...:||.::.:||||...:     ....|:|..::|...|   |:::..|:|   .|.|
  Rat   229 IEFHDIHLQVFKEMMAFIYTGKAPHLHSHSMATGLLAAADMYDLQE---LKDMCEDSL---CRNL 287

  Fly   134 RFANILPALELSVCMGLDGLLEVCMTFFMRCCVNNGQYMSHLKEHYVHVSK--ECV--KAIIAAC 194
            ...|.:|.|.|:.......|....|.|.:                 :|.|:  |.|  |:::.: 
  Rat   288 SVKNAVPTLILADLHSTKHLKTRAMDFII-----------------LHASEVSETVGWKSMVES- 334

  Fly   195 KEPHKLLIWYVYEWTRQECEQLGLGPS 221
             .|| |:....|..:..:|.  ||.||
  Rat   335 -HPH-LVEEAFYSLSSIQCP--GLEPS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 35/104 (34%)
BTB 33..122 CDD:197585 32/93 (34%)
LOC100911679XP_003749384.1 MATH 16..153 CDD:295307
BTB 180..284 CDD:279045 36/110 (33%)
BTB 189..287 CDD:197585 35/104 (34%)
SPOP_C 287..348 CDD:269807 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.