DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and Tdpoz7

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001157203.1 Gene:Tdpoz7 / 100042761 MGIID:3710527 Length:340 Species:Mus musculus


Alignment Length:123 Identity:42/123 - (34%)
Similarity:62/123 - (50%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSAIFKVL 87
            |:|...:.:|||...|...:.:.||.||::.||||.|||...|:.....| .||||:...:||.:
Mouse   179 GELWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAMFEHEMEERLGNP-TEIHDLDPKVFKEM 242

  Fly    88 VEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLRFANILPALELS 145
            :.:||||...:.....:| .::..||:||.||.|.......:.|.|...|....|.|:
Mouse   243 MGFIYTGKAPHLQSHSMA-TDVLTAADKYGLEGLKVLCEDALCRNLSVENAAQTLILA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 36/98 (37%)
BTB 33..122 CDD:197585 33/88 (38%)
Tdpoz7NP_001157203.1 MATH 16..153 CDD:295307
BTB 178..284 CDD:279045 37/106 (35%)
BTB 189..287 CDD:197585 35/99 (35%)
SPOP_C 287..339 CDD:269807 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.