DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxo42 and NSP2

DIOPT Version :10

Sequence 1:NP_611647.1 Gene:Fbxo42 / 37532 FlyBaseID:FBgn0034704 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001189663.1 Gene:NSP2 / 817869 AraportID:AT2G33070 Length:473 Species:Arabidopsis thaliana


Alignment Length:283 Identity:69/283 - (24%)
Similarity:105/283 - (37%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LEKGLIDFRLRWEVFSQQTVNGGAGALLSFIAGRFAHSAVRQDNSMYVFGGGSSSDTTFNDLWRF 134
            ::|.|..|.|....:|.....|.. ..||.:..|.    |...:|:|||||..:| ..:|..:.|
plant   194 IDKHLYVFDLETRTWSISPATGDV-PNLSCLGVRM----VSIGSSLYVFGGRDAS-RKYNGFYSF 252

  Fly   135 DLTHMRW--ARPVATGTYPSPKGSASMVAWRNQLILFGG----WRYPSL-------HPPYQ---- 182
            |.|...|  ..||..|  |:|:...||.|..|.:.:|||    .|..:|       |...|    
plant   253 DTTKNEWKLLTPVEQG--PTPRSFHSMTADENNVYVFGGVSATVRLKTLDAYNIVDHKWVQCSTP 315

  Fly   183 ------------------PW-------CLFDELHYYDLGKNRWLLRSSLSSPP-PMAGHSATVHG 221
                              .|       |..|::|.||..:::|....:....| ..:..::.|.|
plant   316 GGSCSVRGGAGLEVVQGKVWVVYGFNGCEVDDVHCYDPAQDKWTQVETFGEKPCARSVFASAVVG 380

  Fly   222 DRMVVFGGYQIKDDFNVN------SNDTWVLDLPEQRWWQPLFVGNTRPSPRY--------GQIQ 272
            ..::|||| :|..|...:      |..|:.||....:|.:...:|....:|..        |.|.
plant   381 KHILVFGG-EIAMDPKAHEGPGQLSGGTFALDTETLKWEKLDKLGEEEETPSIRGWSASTTGTID 444

  Fly   273 VELGRNHLLIVGGCGGANRVYTD 295
               |:..|::.||....|..:.|
plant   445 ---GKKGLVMFGGKAQTNDRFGD 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxo42NP_611647.1 F-box_FBXO42 24..61 CDD:438882
NanM <101..307 CDD:442289 61/252 (24%)
KELCH repeat 103..148 CDD:276965 16/46 (35%)
KELCH repeat 154..209 CDD:276965 18/94 (19%)
KELCH repeat 212..257 CDD:276965 13/50 (26%)
KELCH repeat 267..314 CDD:276965 8/37 (22%)
NSP2NP_001189663.1 PLN02193 1..473 CDD:177844 69/283 (24%)
KELCH repeat 169..220 CDD:276965 6/26 (23%)
KELCH repeat 224..269 CDD:276965 17/51 (33%)
KELCH repeat 272..313 CDD:276965 11/40 (28%)
KELCH repeat 322..368 CDD:276965 7/45 (16%)
KELCH repeat 371..420 CDD:276965 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.