DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxo42 and Klhdc1

DIOPT Version :10

Sequence 1:NP_611647.1 Gene:Fbxo42 / 37532 FlyBaseID:FBgn0034704 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_839984.1 Gene:Klhdc1 / 271005 MGIID:2672853 Length:406 Species:Mus musculus


Alignment Length:133 Identity:27/133 - (20%)
Similarity:45/133 - (33%) Gaps:49/133 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 DGHPEEFAKYLRYVRRLDFFETPDYDHLRRLFQDLFYFKGYVDDGEFDWTGKTMSTP-------V 314
            |...||.|        :|:...|.:.::.||.:.|...:          |.|::|..       :
Mouse   141 DDGDEETA--------VDYQNIPGFQNVDRLAEYLVELR----------THKSLSLTNQEADEII 187

  Fly   315 GSLQTGHE-----VVV--------------SPNRERHTPANKQT-----NSKGGVAAWPDVPKQT 355
            |..|:.|:     ||.              :|.:..|||..:.|     .:....|.|||..:..
Mouse   188 GLWQSLHDQDKKRVVYAARHQKRLLSGRFKTPKKPTHTPGVESTTRCVLGASSAPAQWPDCCRLV 252

  Fly   356 GTL 358
            .|:
Mouse   253 ETI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxo42NP_611647.1 F-box_FBXO42 24..61 CDD:438882
NanM <101..307 CDD:442289 9/49 (18%)
KELCH repeat 103..148 CDD:276965
KELCH repeat 154..209 CDD:276965
KELCH repeat 212..257 CDD:276965 27/133 (20%)
KELCH repeat 267..314 CDD:276965 8/53 (15%)
Klhdc1NP_839984.1 NanM 10..321 CDD:442289 27/133 (20%)
KELCH repeat 13..66 CDD:276965
Kelch 1 24..76
KELCH repeat 70..120 CDD:276965
Kelch 2 80..134
Kelch 3 135..181 12/57 (21%)
KELCH repeat 197..245 CDD:276965 8/47 (17%)
Kelch 4 208..258 10/48 (21%)
KELCH repeat 248..295 CDD:276965 1/8 (13%)
Kelch 5 260..307
Kelch 6 311..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.