DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxo42 and KLHDC1

DIOPT Version :10

Sequence 1:NP_611647.1 Gene:Fbxo42 / 37532 FlyBaseID:FBgn0034704 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_751943.1 Gene:KLHDC1 / 122773 HGNCID:19836 Length:406 Species:Homo sapiens


Alignment Length:236 Identity:60/236 - (25%)
Similarity:93/236 - (39%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RFAHSAVRQDNSMYVFGGGSSSDTT-----FNDLWRFDLTHMRWARPVATGTYPSPKGSASMVAW 162
            |..|.||...|.:||:||..|.:..     .:::|.:|:....|...:..|..|:....:.....
Human    13 RSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWRMHLMEGELPASMSGSCGACI 77

  Fly   163 RNQLILFGGWRYPSLHPPYQPWCLFDELHYYDLGKNR-----WLLRSSLSSPPPMAGH--SATVH 220
            ..:|.:|||         |......:.|::.:| :.|     |...:.....||....  |..|:
Human    78 NGKLYIFGG---------YDDKGYSNRLYFVNL-RTRDETYIWEKITDFEGQPPTPRDKLSCWVY 132

  Fly   221 GDRMVVFGGY------QIKDDFNVNS------------NDTWVLDLPEQRWWQPLFVGNTRPSPR 267
            .||::.||||      :::|.|:|:.            ||..:.|...|.|:||...|...|.||
Human   133 KDRLIYFGGYGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTKTQTWFQPEIKGGVPPQPR 197

  Fly   268 YGQIQVELGRNHLLIVGGCGGANRVYTDAWLLDMTRDVWSW 308
            .......|| |...|.||.....|: .|...|::  |.|:|
Human   198 AAHTCAVLG-NKGYIFGGRVLQTRM-NDLHYLNL--DTWTW 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxo42NP_611647.1 F-box_FBXO42 24..61 CDD:438882
NanM <101..307 CDD:442289 58/233 (25%)
KELCH repeat 103..148 CDD:276965 13/49 (27%)
KELCH repeat 154..209 CDD:276965 9/59 (15%)
KELCH repeat 212..257 CDD:276965 17/64 (27%)
KELCH repeat 267..314 CDD:276965 13/42 (31%)
KLHDC1NP_751943.1 NanM <10..93 CDD:442289 20/88 (23%)
KELCH repeat 13..65 CDD:276965 14/51 (27%)
Kelch 1 24..76 10/51 (20%)
NanM 63..327 CDD:442289 47/186 (25%)
KELCH repeat 69..194 CDD:276965 30/134 (22%)
Kelch 2 80..134 13/63 (21%)
Kelch 3 135..181 11/45 (24%)
KELCH repeat 197..235 CDD:276965 13/42 (31%)
Kelch 4 208..258 9/30 (30%)
KELCH repeat 248..294 CDD:276965
Kelch 5 260..307
Kelch 6 311..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.