DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and PUS1

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_015112.1 Gene:PUS1 / 855889 SGDID:S000006133 Length:544 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:50/192 - (26%)
Similarity:71/192 - (36%) Gaps:51/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AEGKVSQVAKTSSKVQKIRKFDWSSAH-------------------------KRHVLLKITYFGW 110
            |:.|:::..|.....:|.:|.| :..|                         ||.|.:.:.|.|.
Yeast    23 AQSKLTKARKADFDDEKDKKKD-NDKHIDKRPKSGPRLDENGNPLPKEPRLPKRKVAVMVGYCGT 86

  Fly   111 DYQGFACQEDSNDTIESNLFRALARTCLIESRATSN------YHRCGRTDKEVSAFCQVISIDLR 169
            .|.|.. ....|.||||.||:|......| |:..||      :.|..||||.|.|...:||:.:.
Yeast    87 GYHGMQ-YNPPNPTIESALFKAFVEAGAI-SKDNSNDLKKNGFMRAARTDKGVHAGGNLISLKMI 149

  Fly   170 SKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLR-SPVYSARFDCVSRTYRYYFP 230
            .:.|...|              .:|..||:.|:  .|...| :..:..|..|.||.|.|..|
Yeast   150 IEDPDIKQ--------------KINEKLPEGIR--VWDIERVNKAFDCRKMCSSRWYEYLLP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 41/137 (30%)
PseudoU_synth_ScPus3 103..356 CDD:211336 40/135 (30%)
PUS1NP_015112.1 PseudoU_synth_PUS1_PUS2 79..407 CDD:211335 40/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1490
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.