DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and PUS2

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_011452.4 Gene:PUS2 / 852817 SGDID:S000003031 Length:370 Species:Saccharomyces cerevisiae


Alignment Length:346 Identity:65/346 - (18%)
Similarity:108/346 - (31%) Gaps:126/346 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YFGWDYQGFACQEDSNDTIESNLFRALARTCLIESRAT-----SNYHRCGRTDKEVSAFCQVISI 166
            |:|..|      ...:.|||..:...|.....|....:     :::....||||.|.|...::|:
Yeast    10 YYGMQY------NPPHKTIEGEILTKLFDVGAISEENSLAPKKNSFMAAARTDKGVHAMLNLLSL 68

  Fly   167 DLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFPK 231
            .:..:.               |....||..||..|:.....|:... ::||..|.||.|:|..|:
Yeast    69 KITLRE---------------DTVAKLNAALPPEIRVWGIQPVNKK-FNARSACDSRWYQYLIPE 117

  Fly   232 -----------------------------------------GD-----LDIAAMRKACDLLVR-- 248
                                                     ||     .|.|......|.||:  
Yeast   118 FILIGPPRSSLLHRNVGGCYREDGSQEVWDTFLEQTRGRFSGDELCRLQDTAQKLSESDPLVQDY 182

  Fly   249 ----HADFRNFC----KMDV--------------HNGVTNYM-------RNLQSARVEACDQTNH 284
                ......:|    |:|.              ||..|..:       |:::...|      :.
Yeast   183 VGLLSGTLSGYCLSPSKLDAFEAAMQEYVGTHNFHNFTTGKLWGDPSAQRHIKKVVV------SQ 241

  Fly   285 TNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVESNPCKPQYTPAIGLPL 349
            .:.|:  ..:.|...:|:.||||.::|:.:|..:.:..|.::.:..:.......|: .||.||.|
Yeast   242 ASPGW--ICVRIHGQSFMLHQIRRMVALAVLAARCQLPPNIVRNYFNAGPRKYIPR-APAQGLLL 303

  Fly   350 -------------NLFRCDFR 357
                         ||..|:.|
Yeast   304 EGPVFDGYNTKLRNLLYCEIR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 65/346 (19%)
PseudoU_synth_ScPus3 103..356 CDD:211336 64/343 (19%)
PUS2NP_011452.4 PseudoU_synth_PUS1_PUS2 1..308 CDD:211335 61/328 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.