DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and AT3G06950

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_187351.2 Gene:AT3G06950 / 819880 AraportID:AT3G06950 Length:323 Species:Arabidopsis thaliana


Alignment Length:311 Identity:79/311 - (25%)
Similarity:133/311 - (42%) Gaps:52/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TSSKVQKIRKFDWSSAHKRHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLIESRATS 145
            :|.||.....:.|.        |.|.|.|..:.|:..|| |..||:|.|.:||.:...: .|...
plant    31 SSVKVSDSGAYKWR--------LVIAYDGTRFAGWQYQE-SPPTIQSMLEKALIQITEL-GRKEL 85

  Fly   146 NYHRCGRTDKEVSAFCQVISIDLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLR 210
            .....||||..|.|:.||...           :.|...:|...:...||.:|||:|: |..:...
plant    86 QLIGAGRTDAGVHAWGQVAHF-----------VTPFNYTSLDSFHAALNGLLPKDIR-VRELSAA 138

  Fly   211 SPVYSARFDCVSRTYRY----------------YFPKGDLDIAAMRKACDLLVRHADFRNFCKMD 259
            .|.:.|||...|:.|||                |.....|:.:.||:|.:|.|...||..|....
plant   139 VPEFHARFSASSKVYRYQIYNDTFMDPFQRHWAYHCAYKLNASKMREAANLFVGKHDFSAFANAT 203

  Fly   260 VHNGVTNYMRNLQSARVEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPG 324
            ..:||.:.::.:  :|.:.....:       :..||::.:.||:.|:|.::|:|:.:|::..:..
plant   204 REDGVPDPLKTI--SRFDVIQMGS-------LLQLEVEGSGFLYRQVRNMVALLIQIGKEALDSD 259

  Fly   325 VISDLLDVESNPCKPQYT--PAIGLPLNLFRCDFR-DHTTRSVNHP--SSG 370
            ::..:|:.:......:||  ||....|.|....:: ||....::.|  |||
plant   260 IVPMILETKDRRVLAKYTSLPASPHGLCLVSVKYKEDHLKLPLDCPVTSSG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 75/291 (26%)
PseudoU_synth_ScPus3 103..356 CDD:211336 69/270 (26%)
AT3G06950NP_187351.2 PseudoU_synth_EcTruA 45..293 CDD:211337 69/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100424
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.