DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and CG34140

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001036574.1 Gene:CG34140 / 4379908 FlyBaseID:FBgn0083976 Length:306 Species:Drosophila melanogaster


Alignment Length:326 Identity:79/326 - (24%)
Similarity:123/326 - (37%) Gaps:96/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLIES----RATSNYHR--CGRTDKEVSAF 160
            ||.|:|.|..::|.  |:..|...:|.|.....:.||..:    ..|:..|.  ..|||..|.|.
  Fly     5 LLNISYIGTTFRGI--QKTVNKLEQSRLDTKSIQGCLELALQVFHPTNEIHTVLSSRTDAGVHAL 67

  Fly   161 CQVISIDLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLR-------SPVYSARF 218
            ...:.:||  :.|.....|.|.|:      |:|||.|.|.     .:|:|       :..:..|:
  Fly    68 HSTVQVDL--ERPNGQPYDTTILT------GVLNRTLNKQ-----RLPIRVLSSKLVANSFHCRY 119

  Fly   219 DCVSRTYRYYF------PKGD---------------------------LDIAAMRKACDLLVRHA 250
            |.:.|||.|.|      ..||                           .||..::.|..:.:...
  Fly   120 DAIGRTYLYRFAVAKVPTLGDCSLRNRSFETFIPVEEIDRCYFLQSSSFDIKRVQAAARMFIGVH 184

  Fly   251 DFRNF--------C---------KMDVHNGVTNYMRNLQSARVEACDQTNHTNSGYDMYYLEIQA 298
            |||.|        |         |:|..|......|.|.|..::|.:.       |:.:.:||:|
  Fly   185 DFRTFMSVSRQKVCRDHPMFTVRKIDEINIRPGETRALSSNAIQAAET-------YNYWDIEIRA 242

  Fly   299 NAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVESNPCKPQY------TPAIGLPLNLFRCDFR 357
            .:||:.|:|.|:..|:.:|..:.:...:..:|.|   |.|..:      .||.|  |.|.|..:|
  Fly   243 KSFLYKQVRRIVGALIALGNGRIDERCLYQMLTV---PSKNSWDHRVLLAPACG--LYLCRVHYR 302

  Fly   358 D 358
            :
  Fly   303 E 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 79/326 (24%)
PseudoU_synth_ScPus3 103..356 CDD:211336 77/321 (24%)
CG34140NP_001036574.1 truA 1..301 CDD:234577 78/322 (24%)
PseudoU_synth_EcTruA 6..301 CDD:211337 77/321 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450171
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100424
Panther 1 1.100 - - P PTHR11142
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.