DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and Pusl1

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001382537.1 Gene:Pusl1 / 362681 RGDID:1559560 Length:291 Species:Rattus norvegicus


Alignment Length:280 Identity:71/280 - (25%)
Similarity:111/280 - (39%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLKITYFGWDYQGFACQEDSNDT--IESNLFRALARTCLIES-RATSNYHRCGRTDKEVSAFCQV 163
            |:...|.|.|:.|.|....::..  :::.|..|..|...:|. |.|.:    .|||..|.|....
  Rat    15 LVFFQYLGTDFNGVAAVRGNHRAVGVQNFLEEAAKRLNSVEPVRFTIS----SRTDAGVHALSNA 75

  Fly   164 ISIDL--RSKHPPES-QLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSP-VYSARFDCVSRT 224
            ..:|:  |...||.| ::...||::.:.:..:  |||         ...|.| .:.||....|||
  Rat    76 AHLDIQRRPGRPPFSPEIVTKALNTHLKHPAI--RVL---------KAFRVPNDFHARHAATSRT 129

  Fly   225 YRYYFPKG---------------------DLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYM 268
            |.|....|                     .||||||::|...|:...||..|  ....:.|.:.:
  Rat   130 YLYRLATGCSGPNQLPVFEQNVCWSLQTEYLDIAAMQEAAQHLLGTHDFSAF--QSAGSPVPHAV 192

  Fly   269 RNLQSARVEACDQT----NHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDL 329
            |.|:...|.....:    ...:.....:.||.::.:||:.|:|.:.|||:.||.....|..:..:
  Rat   193 RTLRRVSVSPGPASLFVLPQESRRLQFWTLEFESQSFLYRQVRRMTAVLVAVGLGILAPTQVKVI 257

  Fly   330 LDVESNPCKPQ--YTPAIGL 347
            |:.:....|.|  ..||.||
  Rat   258 LESQDPLGKYQARVAPAHGL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 71/280 (25%)
PseudoU_synth_ScPus3 103..356 CDD:211336 70/279 (25%)
Pusl1NP_001382537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100424
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.