DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and Pus1

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001020734.1 Gene:Pus1 / 304567 RGDID:1311871 Length:423 Species:Rattus norvegicus


Alignment Length:387 Identity:87/387 - (22%)
Similarity:145/387 - (37%) Gaps:93/387 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KEYSGLIGNEAEGKVSQVAKTSSKVQKIRKFDWSSAHKRHVLLKITYFGWDYQGFACQEDSND-- 123
            |...|.:..|.|....:| |.....:..||..     ||.::|.:.|.|..|.|......|:.  
  Rat    48 KGRGGWVWEETEHPAKRV-KGGEDEEPPRKLP-----KRKIVLLMAYSGKGYHGMQRNLGSSQFR 106

  Fly   124 TIESNLFRALART-CLIESRATS----NYHRCGRTDKEVSAFCQVISI------DLRSKHPPESQ 177
            |||.:|..||.:. |:.|:..|.    ::.||.||||.|||..||:|:      |:..|      
  Rat   107 TIEDDLVSALVQAGCIPENHGTDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILDK------ 165

  Fly   178 LDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFP-----KGDLDI- 236
                           :|..||.:|:.:....:... ::::..|.:|||.|..|     ..|.|: 
  Rat   166 ---------------INSHLPSHIRILGLKRVTGG-FNSKNKCDARTYCYMLPTFAFAHKDRDVQ 214

  Fly   237 --------AAMRKACDLLVRHADFRNFCKMDVHNGVTNYMRNLQSAR---VEACDQTNHTNSGYD 290
                    ..:::...||..:....||     ||..:.......|||   :|...:......|.:
  Rat   215 DESYRLSAETLQQVNRLLGCYKGTHNF-----HNFTSQKGPREPSARRYILEMYCEEPFVREGLE 274

  Fly   291 MYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVI-----SDLLDVESNPCKPQYTPAIGLPLN 350
            ...::::..:|:.||||.::.:::.:.:......|:     .:.:||...|         ||.|.
  Rat   275 FAVIKVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGEEKVDVPKAP---------GLGLV 330

  Fly   351 LFRCDFRDHTTRSVNHPSSGDADEEAMDTAADESN-----------DLNAPEHLERDLTAWI 401
            |.|..|..:     |.....|...|.:|.|.:|..           .:.:.|..||.:..|:
  Rat   331 LERVHFEKY-----NQRFGSDGLHEPLDWAQEEGKVTAFKEQYIYPTIVSTERDERSMAQWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 69/309 (22%)
PseudoU_synth_ScPus3 103..356 CDD:211336 66/287 (23%)
Pus1NP_001020734.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..75 6/27 (22%)
PseudoU_synth_PUS1_PUS2 84..336 CDD:211335 66/287 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..423
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.