DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and PUSL1

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_024308825.1 Gene:PUSL1 / 126789 HGNCID:26914 Length:394 Species:Homo sapiens


Alignment Length:146 Identity:38/146 - (26%)
Similarity:58/146 - (39%) Gaps:22/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SSAHKRHVLLKITYFGWDYQGFACQEDSNDT--IESNLFRALARTCLIES-RATSNYHRCGRTDK 155
            |.:.:...|:...|.|.|:.|.|....:...  :::.|..|..|...:|. |.|.:    .|||.
Human     7 SGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTIS----SRTDA 67

  Fly   156 EVSAFCQVISIDL--RSKHPP-ESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPV-YSA 216
            .|.|......:|:  ||..|| ..::...||::.:.:..:  |||         ...|.|. :.|
Human    68 GVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRHPAI--RVL---------RAFRVPSDFHA 121

  Fly   217 RFDCVSRTYRYYFPKG 232
            |....||||.|....|
Human   122 RHAATSRTYLYRLATG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 37/139 (27%)
PseudoU_synth_ScPus3 103..356 CDD:211336 36/137 (26%)
PUSL1XP_024308825.1 PseudoU_synth 18..>158 CDD:320773 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100424
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.