DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11269 and rnaseka

DIOPT Version :9

Sequence 1:NP_611644.1 Gene:CG11269 / 37527 FlyBaseID:FBgn0034700 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001038870.1 Gene:rnaseka / 751692 ZFINID:ZDB-GENE-060825-301 Length:101 Species:Danio rerio


Alignment Length:96 Identity:38/96 - (39%)
Similarity:54/96 - (56%) Gaps:2/96 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFCGRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHH-FPSQEAFKEQADEAYQDVS 64
            :|||.|.....|.:|.||.:||.||||||...|.:|:|.:||... ..||:...:...:.|..|.
Zfish     5 LFCGPKLAACGLVLSIWGVIMLALLGIFFTTHSAILIEDVPLTEEDLHSQDTPPQSVYKLYNQVG 69

  Fly    65 TRCFVAAVFYLGFVFIAIVAIRRDNKRRKRL 95
            ..||:|||.|:|..|::...:|. |||::.|
Zfish    70 YNCFIAAVIYVGIGFLSFCQVRL-NKRKEYL 99



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1615928at2759
OrthoFinder 1 1.000 - - FOG0004618
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31733
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3452
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.