DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11269 and YPR170W-B

DIOPT Version :9

Sequence 1:NP_611644.1 Gene:CG11269 / 37527 FlyBaseID:FBgn0034700 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001106949.1 Gene:YPR170W-B / 5848745 SGDID:S000028515 Length:85 Species:Saccharomyces cerevisiae


Alignment Length:90 Identity:21/90 - (23%)
Similarity:37/90 - (41%) Gaps:18/90 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQEAFKEQADEAYQDVSTRCF 68
            |:..|  |..:||:|.::|:::...|.......:.|:..|...|:              |:...:
Yeast     8 GKAWC--CTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPA--------------VAHTVY 56

  Fly    69 VAAVFYLGFVFIAIVAIRRDNKRRK 93
            :||:.||  ||......:....|||
Yeast    57 LAALVYL--VFFVFCGFQVYLARRK 79



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.