DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:321 Identity:102/321 - (31%)
Similarity:154/321 - (47%) Gaps:111/321 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TYSCNSPSKPSDSL--SSASMKLLILTSLLAVATA----APGLLDYG-HSAPDYSYAHAAPAI-- 60
            ||:..||:....::  |...:|.|:..::..:..:    :||:.... :::|.|||:.|:|.|  
  Fly   125 TYADKSPAAKYATVVPSGIEIKNLVSPAVTKLDNSYLPPSPGITKVATYTSPGYSYSSASPGISK 189

  Fly    61 --TYAA---------AAPV---IKSYAAPAITYAAPAP---VIKSYAAPAISY----------AH 98
              ||::         |.||   :::|::||.||:...|   .:::|::|..||          |.
  Fly   190 VATYSSPSLSSVPYYAPPVTSKVETYSSPAYTYSKTTPGYSKVETYSSPGYSYGQISPGISRIAT 254

  Fly    99 AAPAISYAAPTVVK--SYAAPVAVKVA-----------------APA-TSYSHFSSVVSH---AT 140
            .:|::||:|||:.|  :|:|| :||:|                 ||: |.||..|. |||   :.
  Fly   255 YSPSVSYSAPTIAKVSTYSAP-SVKLATTSSLLSSHGTGYSASYAPSITKYSQVSD-VSHQYISK 317

  Fly   141 PIVKSYAA-----------------------PAIA----YAAP-------APVIK----SYAAP- 166
            |||.:|.|                       ||||    ||||       .|.|.    ||.|. 
  Fly   318 PIVAAYPAITKVAASYGGTASGALSHQYVSQPAIAKVSTYAAPTVATYSSGPAISKLSTSYGASG 382

  Fly   167 --AISYAHAA-PAISYAAPTVVK--SYAAPAI-SYA-APAL--VKSYAAPALSL--GGYGY 216
              |:|:.:.: ||::.|||.|.|  :|||||| ||: .||:  |.|||||.:|.  .||||
  Fly   383 SGAVSHQYVSKPAVAIAAPAVAKVATYAAPAISSYSTGPAISKVASYAAPTVSTYSSGYGY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.