DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG13044

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster


Alignment Length:196 Identity:65/196 - (33%)
Similarity:89/196 - (45%) Gaps:69/196 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLLILTSLLAVATAAPGLLDYGHSAPDYSYAHAAPAITYAAAAPVIKSYAAPAITYAAPAPVIKS 88
            ||.:|.:|||||.|.||                     :.||||::  |:|||.|.....||:..
  Fly     3 KLFVLAALLAVAAAKPG---------------------HLAAAPLV--YSAPATTTVVQEPVLAK 44

  Fly    89 YAAPAISYAHAAPAISYAAPTVVKSYAAPVAVKVAAPATSYSHFSSVVSHATPIVKSYAAPAI-- 151
            ..|                  ||||  .|.||         ||.|....|:||:|:...||.:  
  Fly    45 VGA------------------VVKS--VPTAV---------SHQSLTQVHSTPVVEDVVAPVVKT 80

  Fly   152 --AYAAP----APVIKSYAAPAISYAHAAPAISYAAPTVVKSYAAPAISYAAPALVK---SYAAP 207
              .::||    ||::|:.|    ..|::|| ::|:||....||||| ::|:||....   |||||
  Fly    81 TAVHSAPVLAAAPIVKTLA----PVAYSAP-LAYSAPVAYSSYAAP-LTYSAPVAYSAPLSYAAP 139

  Fly   208 A 208
            |
  Fly   140 A 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG13044NP_648867.1 Retinin_C 36..93 CDD:282395 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D4X2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.