DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and Cpr56F

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:108 Identity:31/108 - (28%)
Similarity:42/108 - (38%) Gaps:29/108 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FSSVV--------SHATPIV--KSYAAPAIAYAAPA----PVIKSYAAPAISYA--------HAA 174
            |:|:.        :||.|.|  ..|..|..:..||:    |..:.|.:|:.:|.        ..|
  Fly     4 FTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQSPSSNYLPPQRAGGNGGA 68

  Fly   175 PAISYAAPTVVKSYAAPAISYAAPALVKSY--AAPALSLGGYG 215
            |:.||.||     .|.|...|.||||..:.  .......||||
  Fly    69 PSNSYGAP-----IAPPQGQYGAPALTGAIFKGGNGNGNGGYG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.