DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG17290

DIOPT Version :10

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_611196.2 Gene:CG17290 / 36938 FlyBaseID:FBgn0034201 Length:99 Species:Drosophila melanogaster


Alignment Length:117 Identity:35/117 - (29%)
Similarity:46/117 - (39%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MKLLILTSLLAVATAAPGLLDYGH-SAPDYSYAHAAPAITYAAAAPVIKSYAAPAITYAAPAPVI 86
            ||.||    :|:|..|....|... |..||.....||..||...||            .||||| 
  Fly     1 MKFLI----IAIAFLACAFADVSELSGYDYQQPAPAPVETYIPPAP------------PAPAPV- 48

  Fly    87 KSYAAPAISYAHAAPAISYAAPTVVKSYAAPVAVKVAAPATSYSHFSSVVSH 138
            ::|..|      |.||..|..|..|:: ..|:..::..||.....:.:|..|
  Fly    49 ETYIPP------APPAPEYIPPAPVQA-EEPIIEEIEQPAQDGYRYKTVRRH 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG17290NP_611196.2 GYR 82..99 CDD:128953 2/12 (17%)

Return to query results.
Submit another query.