DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG32564

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster


Alignment Length:247 Identity:98/247 - (39%)
Similarity:135/247 - (54%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSTYSCNSPSKPSDSLSSASMKLLILTSLLAVATAAPGLLDYGHSAPDYSYAHAAPAITYAAAAP 67
            :|:.|.||.|.||.|.|:.:.         ||..:||        ||..||:..|||:||:|.||
  Fly   149 SSSASANSYSAPSVSYSAPAP---------AVTYSAP--------APAVSYSAPAPAVTYSAPAP 196

  Fly    68 VIKSYAAPAITYAAPAPVIKSYAAPAISYA--HAAPAISYAAPTVVK--SYAAPVAVKV----AA 124
                  |||:||:|||||::..||||::|:  ..|||::|:||....  :|:||....|    ||
  Fly   197 ------APAVTYSAPAPVVRVQAAPAVTYSAPAPAPAVTYSAPAPAPAVTYSAPAPAPVVRVQAA 255

  Fly   125 PATSYSHFSSVVSHATP---IVKSYAAPAIAYAAPAPV-IKSYAAPA---ISYAHAAPAISYA-- 180
            ||.:||..:..|:::.|   :..|..|||:.|:||||| :..|:|||   ||||.|  .:|||  
  Fly   256 PAVTYSAPAPAVTYSAPAPAVTYSGPAPAVTYSAPAPVPVVRYSAPAPAPISYAPA--PVSYAPQ 318

  Fly   181 --APTVVKSY-------AAPAISYAAPALVKSY----AAPALSLGGY--GYH 217
              :..|||:.       .|||..|..||:..||    ::.|.|.|||  ||:
  Fly   319 PQSQQVVKTIKLIVDEDRAPAQVYGPPAVESSYSSASSSAAASAGGYNGGYN 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 72/178 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.