DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG11585

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster


Alignment Length:293 Identity:100/293 - (34%)
Similarity:138/293 - (47%) Gaps:103/293 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SMKLLILTSLLAVATAAP-----------GLLDYGHSAPDYSYAHAAPAITYAA----------- 64
            |..:||| ||.:|..|.|           ....|..:|...|.::||||.|||.           
  Fly     3 SFAILIL-SLASVGLATPLSNTYLPPKVGAQSGYSAAASSSSGSYAAPAATYARRSHSVAAPSRQ 66

  Fly    65 ------------------AAPVIK--SYAAPA-------ITYAAPAPVIKSYAAPAISYAH---- 98
                              |||.:.  ||:|||       ::|:|||....|||||::|:..    
  Fly    67 YLAPASSHGSYSSGGSSYAAPSVSHVSYSAPAASASASHVSYSAPAAAHSSYAAPSVSHGSYSSA 131

  Fly    99 ---------AAPAISYAAPTVV--KSYAAPVAVK--VAAPATSYSHFS----SVVSHATPIV--K 144
                     |||:..|.||..|  .||:|||..:  .:|||.|:..:|    |..|::.|:.  .
  Fly   132 SRTSYSAPVAAPSRKYLAPAAVSHSSYSAPVVSRKSYSAPAVSHGSYSSSGGSSGSYSAPVASYS 196

  Fly   145 SYAAPA---IAYAAP---------APVIKSYAAPAISYAHAAPAI-SYAAPTVVKSYAAPAI--- 193
            ||:|||   .:|:||         ||...||:|||:| :::|||: ||:|| .|.||:|||:   
  Fly   197 SYSAPAASHTSYSAPVAAPSRQYLAPAASSYSAPAVS-SYSAPAVSSYSAP-AVSSYSAPAVSHG 259

  Fly   194 -----------SYAAPAL-VKSYAAPALSLGGY 214
                       |||||:: .|:|||||:|.|.|
  Fly   260 SSYSTSSLSHGSYAAPSVSSKTYAAPAVSHGSY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 46/125 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.