DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG11584

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster


Alignment Length:268 Identity:88/268 - (32%)
Similarity:129/268 - (48%) Gaps:76/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TYSCNSPSKPSDSLSSASMKLLILTSLLAVATAAPGLLDYGHSAPDYSYAHAAPAI--TYAAAAP 67
            |||..:| ...:...||...::..||.......|| :.:..:|||       ||||  ||:|.||
  Fly   255 TYSAPAP-VTQEQYYSAPASVVQQTSSAPAPAPAP-VQEQFYSAP-------APAIQQTYSAPAP 310

  Fly    68 ---VIKSYAAPA----ITYAAPAP-------VIKSYAAPA------ISYAHAAP---------AI 103
               |.::|:|||    .||:||||       |::||:|||      .:|::.||         |:
  Fly   311 APVVQQTYSAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAV 375

  Fly   104 SYAAPTVVKSYAAPVAVKV-----AAPATSYSHF---SSVVSHATPIVKSYAAPAIA------YA 154
            :..||.|.:||:||....|     :|||......   :.|:..|..:.:||:|||.|      |:
  Fly   376 AQQAPVVQQSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYS 440

  Fly   155 APAPVIKS--------YAAPAISYAHAAPA-----------ISYAAPTVVKSYAAPAISYAAPAL 200
            |||||::.        ..||.:..:::|||           :...||.|.:||:|||   .||.:
  Fly   441 APAPVVQETIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPA---PAPVV 502

  Fly   201 VKSYAAPA 208
            .:||:|||
  Fly   503 QQSYSAPA 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG11584NP_572941.1 rne <209..408 CDD:236766 54/161 (34%)
rne <329..539 CDD:236766 60/185 (32%)
TFIIA 475..>635 CDD:281188 15/39 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.