DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG1368

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster


Alignment Length:209 Identity:83/209 - (39%)
Similarity:129/209 - (61%) Gaps:40/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MKLLILTSLLAVATAAPGLLDYGHSAPDYSYAHAAPAITYAAAAPVIKSYAAPAITYAAPAPVIK 87
            ||.||..:|.|...|     |..|.:.:|             ..||..|||||:::|:||| |.:
  Fly     1 MKFLIAFALFACVAA-----DVSHLSNEY-------------LPPVQSSYAAPSVSYSAPA-VQQ 46

  Fly    88 SYAAPAISYAHAAPAISYAAPTVVKSYAAPVAVKV-AAPATSYSHFSSVVSHATPIVKSYAAPAI 151
            :||||||..::.||:..|..|  |::|:||...:. :|||...::.:..||::.|.| ||:||::
  Fly    47 TYAAPAIQQSYVAPSNEYLPP--VQTYSAPAVQRTYSAPAVQRTYSAPSVSYSAPSV-SYSAPSV 108

  Fly   152 AYAAPAPVIKSYAAPAISY-------AHAAPAISYAAPTVVKSYAAPAISYAAPALVKSYAAPAL 209
            :|:||| |.:||:||::||       :::||::||:||.|.:||:|||:||:||::  ||:||::
  Fly   109 SYSAPA-VQQSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSYSAPAVSYSAPSV--SYSAPSV 170

  Fly   210 -------SLGGYGY 216
                   |.|||.|
  Fly   171 DVGTQYASNGGYVY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 72/181 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I17296
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.