DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG2962

DIOPT Version :10

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572612.2 Gene:CG2962 / 31952 FlyBaseID:FBgn0030186 Length:376 Species:Drosophila melanogaster


Alignment Length:215 Identity:76/215 - (35%)
Similarity:93/215 - (43%) Gaps:69/215 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GLLDYGHSAPDYS----------------YAHAAPAITYAAA-----APVIKSYAAPAITYAAPA 83
            |:...|:|:..||                :.|:|||...|.|     |||    |||..:|..|.
  Fly   193 GISSGGYSSGGYSSGGYSSGGATKVVRVIHEHSAPAAGPAYAPIDVPAPV----AAPVASYLPPQ 253

  Fly    84 PVIKSYAAPAISYAHAAPAISYAAPTVVKSYAAPVAVKVAAPATSYSHFSSVVSHATPIVKSYAA 148
            .:    ||||..||..|||..||||.....|:||      |||..||         .|      |
  Fly   254 EI----AAPAPVYAAPAPAPVYAAPAPAPVYSAP------APAPVYS---------AP------A 293

  Fly   149 PAIAYAAPAPV-IKSYAAPAISYAHAAPAISYAAPTVVKSYAAPA------ISYAAPALVKSYA- 205
            ||..|:||||. :.|..|||.:|:..|||..|:||.....|||||      :.:.|||.|  :| 
  Fly   294 PAPVYSAPAPAPVYSAPAPAPAYSAPAPAPVYSAPAPAPVYAAPAPAPVLSVPHPAPAPV--FAP 356

  Fly   206 ---------APALSLGGYGY 216
                     |||.:.|..||
  Fly   357 EEQSLPIGHAPAQTYGPPGY 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG2962NP_572612.2 DUF4766 57..189 CDD:435045
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.