DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and CG31626

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:255 Identity:88/255 - (34%)
Similarity:112/255 - (43%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STYSCNSPSKPSDSLSSASMKLLILTSLLAVATAAPGLLDYGHSAPDYSYAHAAPAITYAAAAPV 68
            |.||.|.|: |:.::.||.....:......::..||..: |...||...|:..|||..|:|.||.
  Fly    25 SGYSYNKPT-PTFNIPSAPAPAYLPPVQEVISAPAPAPV-YSAPAPAPVYSAPAPAPVYSAPAPA 87

  Fly    69 --------IKSYAAPAITYAAPAPV-IKSYAAPAISYAHAAPAISY-------AAPTVVKSYAAP 117
                    ::...|||..|:||||. :.|..|||..|:..|||..|       .||.....|:||
  Fly    88 PVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPEYLPPVQDIPAPAPAPVYSAP 152

  Fly   118 VAVKV---AAPATSYS-HFSSVVSHATPIVKSYAAPAIAYAAPAPV-IKSYAAPAISYAHAAPAI 177
            ....|   .|||..|| ...:.||...|.|:...|||..|:||||. :.|..|||..|:..|||.
  Fly   153 APAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAP 217

  Fly   178 SY--------------------AAPTVVKSYAAPAISYAAPALVKSYAAPALSLGGYGYH 217
            .|                    .||..|.|..|||..|:|||....|:|||....||.|:
  Fly   218 EYLPPVQDLPAPAPAPVYSAPAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPVESGYQYN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 62/177 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.