DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and Pou2af1

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_035266.1 Gene:Pou2af1 / 18985 MGIID:105086 Length:256 Species:Mus musculus


Alignment Length:206 Identity:46/206 - (22%)
Similarity:75/206 - (36%) Gaps:53/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SAPDYSYAHAAPAITYAAAAPV----IKSYAAPAITYAAPAPVIKSYAAPAISYAHAAPA---IS 104
            :||:.:.|...|........||    .:.....::..|.|...:.....|..:|:...|:   :.
Mouse     7 TAPEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGAAGPPTAVVLPHQPLATYSTVGPSCLDME 71

  Fly   105 YAAPTVVK---------SYAAPVAVKVAAPATSYSHFSSVVSH------------ATPIVKSYA- 147
            .:|.||.:         |..||..::..||.|.|:.:   |||            ..|:..||. 
Mouse    72 VSASTVTEEGTLCAGWLSQPAPATLQPLAPWTPYTEY---VSHEAVSCPYSTDMYVQPVCPSYTV 133

  Fly   148 ---APAIAYAAPAPVI-----KSYAAPAI-----SYAHAAPAISYAAPTVVKSYAAPAISYAAPA 199
               :..:.||:| |:|     :|.|.||:     ...|.||...:..|..:.:....::.|..| 
Mouse   134 VGPSSVLTYASP-PLITNVTPRSTATPAVGPQLEGPEHQAPLTYFPWPQPLSTLPTSSLQYQPP- 196

  Fly   200 LVKSYAAPALS 210
                  ||.||
Mouse   197 ------APTLS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
Pou2af1NP_035266.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 4/16 (25%)
PD-C2-AF1 7..255 CDD:312716 46/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.