DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34205 and pou2af1

DIOPT Version :9

Sequence 1:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_031762006.1 Gene:pou2af1 / 100496996 XenbaseID:XB-GENE-854772 Length:264 Species:Xenopus tropicalis


Alignment Length:126 Identity:27/126 - (21%)
Similarity:44/126 - (34%) Gaps:25/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SAPDYSYAHAAPAITYAA---AAPVIKSYAA---PAITYAAPAPVIKSYAA----PAISYAHAAP 101
            :.|:| .:|...:..|..   ..|:.:.|..   |::......|::.::||    |.:     |.
 Frog   111 TCPEY-ISHETVSCPYTGDMYVQPMCQGYTVVGPPSVLTYTSQPLLTNFAARSANPGV-----AT 169

  Fly   102 AISYA---APTVVKSYAAPVAVKVAAPATSYSHFSSVVSHATPIVKSYAAPAIAYAAPAPV 159
            .|.|.   .|.....:|.|:|....|..|.....:|.....|..|      .|..:.|.||
 Frog   170 QIEYTDHQGPLTYIPWAQPIATLPGATHTIPYQTTSTTFQGTQFV------PIPISLPEPV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34205NP_001097407.1 None
pou2af1XP_031762006.1 PD-C2-AF1 8..263 CDD:401303 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.