DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Angpt1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_006241671.1 Gene:Angpt1 / 89807 RGDID:628896 Length:498 Species:Rattus norvegicus


Alignment Length:275 Identity:98/275 - (35%)
Similarity:141/275 - (51%) Gaps:39/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LEAIYEQAENALSTLQESLLQLETNGTLNTSPDVIYPTSCLTSGDL------------------- 76
            ||....:|.|..|.||:..|:|     ::|..:::  :.|...|.|                   
  Rat   233 LEKQLSRATNNNSVLQKQQLEL-----MDTVHNLV--SLCTKEGVLLKGGKREEEKPFRDCADVY 290

  Fly    77 -----ENGLHTLKVPGL-SPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEY 135
                 ::|::|:....: .|.:|:|...:.|.||.|||.|..|:|.|.|.|||||.||||...||
  Rat   291 QAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEY 355

  Fly   136 FLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAG--DSLR 198
            :||.|.|.|:|:...:.|.:.|.|::....::::|.|.||||..:|.:...| ::||||  .||.
  Rat   356 WLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKG-HTGTAGKQSSLI 419

  Fly   199 SHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWR 263
            .| ...|||.|.|||:...| ||....||||::||..|||||.:...|:....|  .|:.|..::
  Rat   420 LH-GADFSTKDADNDNCMCK-CALMLTGGWWFDACGPSNLNGMFYTAGQNHGKL--NGIKWHYFK 480

  Fly   264 GHNYGYRVTQMMIRP 278
            |.:|..|.|.|||||
  Rat   481 GPSYSLRSTTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 88/241 (37%)
Angpt1XP_006241671.1 COG4372 <55..>255 CDD:226809 9/26 (35%)
FReD 281..496 CDD:238040 85/220 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.