DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and FCN3

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:215 Identity:87/215 - (40%)
Similarity:117/215 - (54%) Gaps:9/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGF 128
            |.:|   |:.|...:|.:.|.:|......|:|:....|.||:|.|:|..|::.|||:|..|:.||
Human    90 PRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGF 154

  Fly   129 GNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYS-GT 192
            ||...|::||.|.:..||.....||.|.||||:.....|.:..|.:..|.|.|.: .|||:| ||
Human   155 GNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQL-ALGKFSEGT 218

  Fly   193 AGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGM 257
            |||||..|....|:|||.|:|.. |.|||....|.|||.:|..|||||:|...   |.:....|:
Human   219 AGDSLSLHSGRPFTTYDADHDSS-NSNCAVIVHGAWWYASCYRSNLNGRYAVS---EAAAHKYGI 279

  Fly   258 CWRSWRGHNYGYRVTQMMIR 277
            .|.|.||..:.||..:||:|
Human   280 DWASGRGVGHPYRRVRMMLR 299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 87/215 (40%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81
FReD 90..299 CDD:238040 86/213 (40%)