DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and SMC1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_116647.1 Gene:SMC1 / 850540 SGDID:S000001886 Length:1225 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:46/214 - (21%)
Similarity:74/214 - (34%) Gaps:56/214 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLEAIYEQAENALSTLQESLLQLETNGTLNT-------SPDVIYPTSCLTSGD------------ 75
            :||...|:..:.||.|...:..|:  |.:|.       |.......|.:.|..            
Yeast   244 HLEQQKEELTDKLSALNSEISSLK--GKINNEMKSLQRSKSSFVKESAVISKQKSKLDYIFKDKE 306

  Fly    76 -LENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGL 139
             |.:.|..:|||          .|.||.....|:||........:..|.|...|..         
Yeast   307 KLVSDLRLIKVP----------QQAAGKRISHIEKRIESLQKDLQRQKTYVERFET--------- 352

  Fly   140 EKIRALTALEPHELYVHLEDFDDTIKHA--KFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRK 202
             :::.:|..:        |.|::.||.:  .:|:|.: ||:|....|.|.:...|.|.|:...:.
Yeast   353 -QLKVVTRSK--------EAFEEEIKQSARNYDKFKL-NENDLKTYNCLHEKYLTEGGSILEEKI 407

  Fly   203 MKFSTYDRDNDHE---FNK 218
            ...:...|:...|   |||
Yeast   408 AVLNNDKREIQEELERFNK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 36/172 (21%)
SMC1NP_116647.1 Smc 3..1225 CDD:224117 46/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.