Sequence 1: | NP_611641.6 | Gene: | CG30280 / 37522 | FlyBaseID: | FBgn0050280 | Length: | 288 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011526650.1 | Gene: | ANGPTL6 / 83854 | HGNCID: | 23140 | Length: | 537 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 94/206 - (45%) |
---|---|---|---|
Similarity: | 123/206 - (59%) | Gaps: | 4/206 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 SGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFL 137
Fly 138 GLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRK 202
Fly 203 MKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNY 267
Fly 268 GYRVTQMMIRP 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30280 | NP_611641.6 | FReD | 65..279 | CDD:238040 | 94/206 (46%) |
ANGPTL6 | XP_011526650.1 | FReD | 322..535 | CDD:238040 | 94/206 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |