DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fcna

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_112638.2 Gene:Fcna / 83517 RGDID:621221 Length:335 Species:Rattus norvegicus


Alignment Length:215 Identity:96/215 - (44%)
Similarity:128/215 - (59%) Gaps:8/215 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGF 128
            |.||   ||.|....|.:|:.:|...|..|.|:..:.|.||.|.|:|..|:::|:|:|..||.||
  Rat   123 PRSCKDLLTRGIFLTGWYTIYLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSINFYRDWDSYKRGF 187

  Fly   129 GNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKY-SGT 192
            |||..|::||.:.:..|||....||.|.|.:|......||:..|.:..|.:.|.: |||:: .||
  Rat   188 GNLGTEFWLGNDYLHLLTANGNQELRVDLREFQGQTSFAKYSSFQVSGEQEKYKL-TLGQFLEGT 251

  Fly   193 AGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGM 257
            |||||..|..|.|||:|:|||....||||..:.|.|||:.|..|||||:|:||.  .|| :|.|:
  Rat   252 AGDSLTKHNNMAFSTHDQDNDTNGGKNCAALFHGAWWYHDCHQSNLNGRYLPGS--HES-YADGI 313

  Fly   258 CWRSWRGHNYGYRVTQMMIR 277
            .|.|.|||.|.|:|.:|.||
  Rat   314 NWLSGRGHRYSYKVAEMKIR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 96/215 (45%)
FcnaNP_112638.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..114
Collagen <67..108 CDD:396114
FReD 123..333 CDD:238040 94/213 (44%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 13/38 (34%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 34/88 (39%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 291..293 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 326..335 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3251
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3822
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.