DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Mfap4

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001334474.1 Gene:Mfap4 / 76293 MGIID:1342276 Length:281 Species:Mus musculus


Alignment Length:308 Identity:99/308 - (32%)
Similarity:143/308 - (46%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PGVPVFSVCIALSVMIFCHAETLNLFGNLEAIYEQAENALSTLQESLLQLETNGTLNTSPDVIYP 67
            |.:|:  :.:.||:...|..:...:.|:             .|::|.||              .|
Mouse     5 PALPL--MLMLLSMPPPCAPQASGIRGD-------------ALEKSCLQ--------------QP 40

  Fly    68 TSC---LTSGDLENGLHTLKVPGLS-PFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGF 128
            ..|   ...|..|:|::.:...|.| |..|:|:....|..|.|.||||:|::||||.|.:||.||
Mouse    41 LDCDDIYAQGYQEDGVYLIYPYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWSDYKLGF 105

  Fly   129 GNLMDEYF------------------------LGLEKIRALTALEPHELYVHLEDFDDTIKHAKF 169
            |....||:                        |||:.:..||..:.:||.|.||||::...:||:
Mouse   106 GRADGEYWLGKVGPWGGGCPSAKSLLTGCHPSLGLQNLHLLTLKQKYELRVDLEDFENNTAYAKY 170

  Fly   170 DEF-----AIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWW 229
            .:|     ||..|:|.|.:...|...|.|||||..|...||||:|||.| .|.:|||....|.:|
Mouse   171 IDFSISPNAISAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQD-LFVQNCAALSSGAFW 234

  Fly   230 YNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIR 277
            :.:|..:||||.|:.|....   :|.|:.|..|:|..|..:.|:|.||
Mouse   235 FRSCHFANLNGFYLGGSHLS---YANGINWAQWKGFYYSLKRTEMKIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 89/246 (36%)
Mfap4NP_001334474.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43923
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.