DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and TNR

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_003276.3 Gene:TNR / 7143 HGNCID:11953 Length:1358 Species:Homo sapiens


Alignment Length:256 Identity:96/256 - (37%)
Similarity:139/256 - (54%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LEAIYEQAENA--LSTLQESLLQLETNGTLNTSPDVI-YPTSC---LTSGDLENGLHTLKVPG-L 88
            ||.:.|..:..  |...|::.....|:....|...|. :|..|   |.:||..:|::.:.:.| |
Human  1096 LEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQDCAQHLMNGDTLSGVYPIFLNGEL 1160

  Fly    89 S-PFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHE 152
            | ..||||:....|.||||.|:|.:|...|||.|.:|:.||||:.||::|||:.|..:|:...:|
Human  1161 SQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGFGNVEDEFWLGLDNIHRITSQGRYE 1225

  Fly   153 LYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFN 217
            |.|.:.|..:. ..|.:|.|::.:..:.|.:. :|.|:|||||||..|:...|||.|||||....
Human  1226 LRVDMRDGQEA-AFASYDRFSVEDSRNLYKLR-IGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVT 1288

  Fly   218 KNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
             |||..|.|.|||..|..:|||      |||.||..::|:.|..|:||.:.....:|.:||
Human  1289 -NCAMSYKGAWWYKNCHRTNLN------GKYGESRHSQGINWYHWKGHEFSIPFVEMKMRP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 88/220 (40%)
TNRNP_003276.3 EGF_2 <208..230 CDD:285248
EGF_2 267..292 CDD:285248
EGF_2 299..323 CDD:285248
fn3 328..398 CDD:278470
fn3 416..496 CDD:278470
fn3 505..583 CDD:278470
FN3 595..679 CDD:238020
fn3 687..766 CDD:278470
fn3 776..855 CDD:278470
fn3 865..944 CDD:278470
fn3 954..1026 CDD:278470
FN3 1042..1127 CDD:238020 6/30 (20%)
FReD 1133..1342 CDD:238040 86/217 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.