DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Angptl6

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_011240901.1 Gene:Angptl6 / 70726 MGIID:1917976 Length:474 Species:Mus musculus


Alignment Length:242 Identity:95/242 - (39%)
Similarity:134/242 - (55%) Gaps:14/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QESLLQLETNGTLNTSPDVIYPT-------SCLT---SGDLENGLHTLKVPGLSPFQVYCENQLA 100
            ::||.|.....:|..:..:..||       .|..   :|..::|::.|:: |.....|:||.|..
Mouse   233 EQSLRQQGPPSSLLPTGHLAVPTRPVGPWRDCAEAHGAGHWQSGVYDLRL-GRRVVAVWCEQQQE 296

  Fly   101 GPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIK 165
            |.||.|||:|..|:::||.||:.||.|||....||:||||.:..:|:...|||.:.|||:.....
Mouse   297 GGGWTVIQRRQDGSVNFFTNWQHYKAGFGRPEGEYWLGLEPVHQVTSRGDHELLILLEDWGGRAA 361

  Fly   166 HAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWY 230
            .|.:|.|::..|.|.|.:. ||:|.|.|||||..|....|||.|||.| .::.|||.|:.|||||
Mouse   362 RAHYDSFSLEPESDHYRLR-LGQYHGDAGDSLSWHNDKPFSTVDRDRD-SYSGNCALYHRGGWWY 424

  Fly   231 NACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIR 277
            :||..|||||.:..||.| .|.:..|:.|..:||..|..:...|:.|
Mouse   425 HACAHSNLNGVWYHGGHY-RSRYQDGVYWAEFRGGAYSLKKAVMLTR 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 91/223 (41%)
Angptl6XP_011240901.1 PRK09039 57..>154 CDD:181619
AMH_N <116..197 CDD:368070
FReD 259..470 CDD:238040 88/214 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.